PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004485801.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 283aa    MW: 31493 Da    PI: 8.3712
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004485801.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.5e-3844104262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++ alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg r+nk+++
  XP_004485801.1  44 QQGALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGYRRNKRTT 104
                     56689*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.1E-3347102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.16148102IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-244997IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MFSNCEKMVA ISSTTNQWPQ NEIDDGNNKV MEKQQGEEQI LIQQQGALKC PRCDSSNTKF  60
CYYNNYSLSQ PRHFCKACKR YWTRGGTLRN VPVGGGYRRN KRTTTTNTTL IKKPTTLIDA  120
TSISPMFYGL SSSNNNNPRP CDVNLIPLSR FNLSRVSNSG YDGFSTGFMS SETNGYNTSG  180
FNSVMPSVLS STTLQLQHKF MNDGLKYGSN NFQVGLDEEK KVEGQNSKFE WNNGVCQNQI  240
EHVGLYDDSI SNSSLYWNIG SSSGIGVWND QGANIASSLT SLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1468552e-65AC146855.5 Medicago truncatula clone mth2-16c23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004485801.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLG7ISD22e-82G7ISD2_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGGLYMA13G31100.12e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.26e-31Dof family protein